PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AT5G52600.1
Common NameAtMYB82, F6N7.8, MYB82
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Arabidopsis
Family MYB
Protein Properties Length: 201aa    MW: 23292.3 Da    PI: 9.3837
Description myb domain protein 82
Gene Model
Gene Model ID Type Source Coding Sequence
AT5G52600.1genomeTAIRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding51.32.6e-161461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg W +eEd +l+ +v+ +G g+W+ I+r+ g++R +k+c++rw +yl
      AT5G52600.1 14 RGLWKPEEDMILKSYVETHGEGNWADISRRSGLKRGGKSCRLRWKNYL 61
                     788*****************************99************97 PP

2Myb_DNA-binding51.91.7e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++++E++l+++ +k+lG++ W++Ia +++ gRt++++k++w+++l
      AT5G52600.1  67 RGSMSPQEQDLIIRMHKLLGNR-WSLIAGRLP-GRTDNEVKNYWNTHL 112
                      899*******************.*********.************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.392961IPR017930Myb domain
SMARTSM007172.9E-141363IPR001005SANT/Myb domain
SuperFamilySSF466894.87E-2913108IPR009057Homeodomain-like
PfamPF002491.6E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.1E-221568IPR009057Homeodomain-like
CDDcd001677.68E-111761No hitNo description
PROSITE profilePS5129424.61462116IPR017930Myb domain
SMARTSM007174.9E-1666114IPR001005SANT/Myb domain
PfamPF002494.7E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-2469115IPR009057Homeodomain-like
CDDcd001672.00E-1169112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0007275Biological Processmulticellular organism development
GO:0010026Biological Processtrichome differentiation
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0000981Molecular FunctionRNA polymerase II transcription factor activity, sequence-specific DNA binding
GO:0001135Molecular Functiontranscription factor activity, RNA polymerase II transcription factor recruiting
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MECKREEGKS YVKRGLWKPE EDMILKSYVE THGEGNWADI SRRSGLKRGG KSCRLRWKNY  60
LRPNIKRGSM SPQEQDLIIR MHKLLGNRWS LIAGRLPGRT DNEVKNYWNT HLNKKPNSRR  120
QNAPESIVGA TPFTDKPVMS TELRRSHGEG GEEESNTWME ETNHFGYDVH VGSPLPLISH  180
YPDNTLVFDP CFSFTDFFPL L
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-241411527127MYB TRANSFORMING PROTEIN
Search in ModeBase
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO306962140.0
Expression AtlasAT5G52600-
AtGenExpressAT5G52600-
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Mainly expressed in the trichomes of new leaves. {ECO:0000269|PubMed:24803498}.
Functional Description ? help Back to Top
Source Description
TAIRMember of the R2R3 factor gene family.
UniProtTranscription activation factor positively regulating trichomes development (PubMed:24803498). Has a function nearly equivalent to that of GL1 and can complement gl1 mutants (PubMed:24803498). {ECO:0000269|PubMed:24803498}.
Function -- GeneRIF ? help Back to Top
  1. Protein interaction analysis revealed that MYB82 physically interacts with GLABRA3. In addition, MYB82 and GL1 can form homodimers and heterodimers at R2R3-MYB domains, which may explain why their overexpression reduces trichome numbers.
    [PMID: 24803498]
Cis-element ? help Back to Top
SourceLink
PlantRegMapAT5G52600.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By auxin (IAA). {ECO:0000269|PubMed:9839469}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Interaction ? help Back to Top
Source Intact With
BioGRIDAT5G52600
Phenotype -- Mutation ? help Back to Top
Source ID
T-DNA ExpressAT5G52600
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAY5196370.0AY519637.1 Arabidopsis thaliana MYB transcription factor (At5g52600) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_680426.11e-150transcription factor MYB82
SwissprotQ9LTF71e-152MYB82_ARATH; Transcription factor MYB82
TrEMBLD7MS681e-133D7MS68_ARALL; Predicted protein
STRINGAT5G52600.11e-150(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Representative plantOGRP5171784
Publications ? help Back to Top
  1. Stracke R,Werber M,Weisshaar B
    The R2R3-MYB gene family in Arabidopsis thaliana.
    Curr. Opin. Plant Biol., 2001. 4(5): p. 447-56
    [PMID:11597504]
  2. Zimmermann IM,Heim MA,Weisshaar B,Uhrig JF
    Comprehensive identification of Arabidopsis thaliana MYB transcription factors interacting with R/B-like BHLH proteins.
    Plant J., 2004. 40(1): p. 22-34
    [PMID:15361138]
  3. Yanhui C, et al.
    The MYB transcription factor superfamily of Arabidopsis: expression analysis and phylogenetic comparison with the rice MYB family.
    Plant Mol. Biol., 2006. 60(1): p. 107-24
    [PMID:16463103]
  4. Rajagopalan R,Vaucheret H,Trejo J,Bartel DP
    A diverse and evolutionarily fluid set of microRNAs in Arabidopsis thaliana.
    Genes Dev., 2006. 20(24): p. 3407-25
    [PMID:17182867]
  5. Liang G,He H,Li Y,Ai Q,Yu D
    MYB82 functions in regulation of trichome development in Arabidopsis.
    J. Exp. Bot., 2014. 65(12): p. 3215-23
    [PMID:24803498]
  6. Kranz HD, et al.
    Towards functional characterisation of the members of the R2R3-MYB gene family from Arabidopsis thaliana.
    Plant J., 1998. 16(2): p. 263-76
    [PMID:9839469]